General Information

  • ID:  hor006656
  • Uniprot ID:  Q21508
  • Protein name:  Probable insulin-like peptide alpha-type 2
  • Gene name:  ins-22
  • Organism:  Caenorhabditis elegans
  • Family:  Insulin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Caenorhabditis (genus), Peloderinae (subfamily), Rhabditidae (family), Rhabditoidea (superfamily), Rhabditomorpha (infraorder), Rhabditina (suborder), Rhabditida (order), Chromadorea (class), Nematoda (phylum), Ecdysozoa , Protostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  NA
  • GO BP:  NA
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  AHTDKYVRTLCGKTAIRNIANLCPPKPEMKGICSTGEYPSITEYCSMGFSDSQIKFMCCDNQ
  • Length:  62(22-83)
  • Propeptide:  MHTTTILICFFIFLVQVSTMDAHTDKYVRTLCGKTAIRNIANLCPPKPEMKGICSTGEYPSITEYCSMGFSDSQIKFMCCDNQ
  • Signal peptide:  MHTTTILICFFIFLVQVSTMD
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  11-45; 23-58; 33-59
  • Structure ID:  AF-Q21508-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006656_AF2.pdbhor006656_ESM.pdb

Physical Information

Mass: 798619 Formula: C294H466N80O93S9
Absent amino acids: W Common amino acids: CIKST
pI: 7.75 Basic residues: 8
Polar residues: 26 Hydrophobic residues: 13
Hydrophobicity: -38.06 Boman Index: -10175
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 53.55
Instability Index: 3100.48 Extinction Coefficient cystines: 4845
Absorbance 280nm: 79.43

Literature

  • PubMed ID:  9851916
  • Title:  Genome sequence of the nematode C. elegans: a platform for investigating biology.
  • PubMed ID:  9548970
  • Title:  New insulin-like proteins with atypical disulfide bond pattern characterized in Caenorhabditis elegans by comparative sequence analysis and homology modeling.